PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10029520
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 386aa    MW: 43707 Da    PI: 6.132
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10029520genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.15.7e-153885148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++    G g+W+ Iar  g+ R++k+c++rw +yl
      Lus10029520 38 KGLWSPEEDEKLMRYMLSNGQGCWSDIARNSGLQRCGKSCRLRWINYL 85
                     678*******************************************97 PP

2Myb_DNA-binding47.73.7e-1591135147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++++ E++l+++ + +lG++ W+ Ia++++ gRt++++k++w++ 
      Lus10029520  91 RGAFSPHEEDLILHFHSLLGNR-WSQIAARLP-GRTDNEIKNFWNST 135
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-243088IPR009057Homeodomain-like
PROSITE profilePS5129423.9133389IPR017930Myb domain
SuperFamilySSF466893.91E-2835132IPR009057Homeodomain-like
SMARTSM007174.9E-113787IPR001005SANT/Myb domain
PfamPF002494.7E-133885IPR001005SANT/Myb domain
CDDcd001672.94E-94185No hitNo description
Gene3DG3DSA:1.10.10.605.5E-2589141IPR009057Homeodomain-like
PROSITE profilePS5129419.05290140IPR017930Myb domain
SMARTSM007175.1E-1590138IPR001005SANT/Myb domain
PfamPF002491.2E-1391135IPR001005SANT/Myb domain
CDDcd001672.56E-1093136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MRKPALPADH LEMVAEEHDH DHITTTVHKN SKKQRVRKGL WSPEEDEKLM RYMLSNGQGC  60
WSDIARNSGL QRCGKSCRLR WINYLRPDLK RGAFSPHEED LILHFHSLLG NRWSQIAARL  120
PGRTDNEIKN FWNSTLKKRM KSMNDNGNNN NNNNGSPVST SNTNNTTSTL VDNDPNGMMM  180
TSGRNVPLLF HEHDDLIMAT TTMFNADNSL SSSSSTPSSS SSWSSQQYPK IANQCSLGSI  240
QNSMIPSTKF LTSNRDETGI FPQQYHEDDG FVFQPPNYGD HGHYIHHHST HNEMSDLQVE  300
SGRVTSQVVN EDDQLIWFTK AADDHNLVIN DHQWQQLGAY AGTSAGDDDY YFSSCNTSWD  360
LDGFMSTMDN SHYPTTHFLD CQVEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25381427110B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008231282.14e-72PREDICTED: transcription factor MYB86-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.11e-68myb domain protein 46